Bioactive Small Molecules
- (1)
- (2)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (1)
- (2)
- (2)
- (1)
- (1)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (2)
- (2)
- (1)
- (1)
- (2)
- (1)
- (16)
- (2)
- (2)
- (2)
- (27)
- (3)
- (1)
- (2)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (153)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (1)
- (2)
- (4)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (5)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (2)
- (1)
- (1)
- (2)
- (2)
- (1)
- (1)
- (2)
- (1)
- (5)
- (1)
- (1)
- (2)
- (2)
- (2)
- (1)
- (1)
- (2)
- (2)
- (2)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (1)
- (2)
- (2)
- (2)
- (96)
- (1)
- (1)
- (1)
- (2)
- (2)
- (2)
- (1)
- (1)
- (2)
- (2)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (2)
- (1)
- (1)
- (2)
- (10)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (1)
- (1)
- (2)
- (2)
- (1)
- (1)
- (2)
- (2)
- (2)
- (3)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (1)
- (5)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (1)
- (52)
- (2)
- (2)
- (2)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (1)
- (2)
- (2)
- (1)
- (2)
- (1)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (1)
- (2)
- (2)
- (1)
- (2)
- (1)
- (2)
- (1)
- (2)
- (2)
- (1)
- (2)
- (1)
- (1)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (2)
- (2)
- (2)
- (2)
- (1)
- (1)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (1)
- (1)
- (1)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (25)
- (9)
- (1)
- (3)
- (1)
- (2)
- (1)
- (1)
- (1)
- (63)
- (1)
- (2)
- (5)
- (271)
- (2)
- (4)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (2)
- (7)
- (6)
- (1)
- (2)
- (2)
- (1)
- (3)
- (1)
- (91)
- (16)
- (8)
- (2)
- (9)
- (4)
- (2)
- (1)
- (3)
- (4)
- (2)
- (15)
- (2)
- (1)
- (9)
- (2)
- (4)
- (2)
- (2)
- (1)
- (2)
- (7)
- (1)
- (7)
- (3)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (2)
- (1)
Filtered Search Results
Cayman Chemical 4-oxo Retinoic Acid, Purity: ≥95%, CAS: 38030-57-8, 5 mg
An active metabolite of all-trans retinoic acid; binds to RARα, RARβ, and RARγ (IC50s = 59, 50, and 142 nM, respectively, in radioligand binding assays) and induces expression of a luciferase reporter in COS-7 cells expressing RARα, RARβ, or RARγ (EC50s = 33, 8, and 89 nM, respectively); increases protein levels of CK-7 and CK-19 in human epidermal keratinocytes at 1 µM; inhibits the proliferation of MCF-7 breast cancer cells at 10-1,000 nM; is teratogenic to zebrafish embryos (EC50 = 8.1 nM)
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Cayman Chemical FAB-144, Purity: ≥98%, CAS: 2180935-79-7, 10 mg
An analog of XLR11 that has an indazole, rather than an indole group; intended for forensic and research applications
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Cayman Chemical Azilsartan, Purity: ≥98%, CAS: 147403-03-0, 1 g
An AT1 receptor antagonist (IC50 = 0.42 µM) and the active metabolite of azilsartan medoxomil; acts as an inverse agonist, inhibiting angiotensin II-induced accumulation of inositol-1-phosphate in COS-7 cells expressing recombinant human AT1 (IC50 = 2.6 nM); reduces the maximal contractile response induced by angiotensin II in isolated rabbit aortic strips (pD2 = 9.9); inhibits the angiotensin II-induced pressor response in conscious normotensive rats at 100 ng/kg
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Apexbio Technology LLC Azomycin 527-73-1 100mg
Azomycin (CAS 527-73-1) is a small-molecule inhibitor that interferes with electron transport pathways in aerobic Gram-positive and Gram-negative bacteria It is designed to disrupt cellular electron transfer processes thereby inhibiting bacterial respiratory function Azomycin exerts its biological activity primarily through inhibition of microbial electron transport In in vitro assays Azomycin demonstrates inhibitory activity with IC50 values typically in the micromolar concentration range though specific values may vary depending on bacterial strain and experimental conditions Based on these pharmacological properties Azomycin holds research potential in studies of bacterial metabolic pathways antimicrobial resistance mechanisms and novel antibacterial therapeutic strategies
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Nrf2 degrader 1 | 3025286-00-1 | 98.8% | 826.92 | 50 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Nrf2 degrader 1 (compound 1) is a PROTAC Nrf2 degrader with a DC50 of 0.1-1 μM in huH1 cells. It inhibits cancer cell growth for A549 and LK-2 cells with IC50 values of 100 nM and 40 nM, respectively. It can be used for the study of liver cancer, non-small cell lung cancer (NSCLC), and squamous cell carcinoma of lung cancer. The compound structure consists of an Nrf2 Target protein ligand, a Cereblon ligand, and a linker. It is intended for research use only.
- Inhibits cancer cell viability with IC50 values of 100 nM for A549 (lung, carcinoma) and 40 nM for LK-2 (squamous cell carcinoma) after 3 days.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Fmoc-am | 126828-35-1 | 99.8% | 539.58 | 100 G
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
FMOC-AM is a derivative of aminomethyl resin. It provides a solid-phase carrier basis for peptide chain synthesis and can be used in solid-phase peptide synthesis.
- Derivative of aminomethyl resin
- Provides a solid-phase carrier basis for peptide chain synthesis
- Can be used in solid-phase peptide synthesis
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Apexbio Technology LLC CICLOPIROX 25MG
CICLOPIROX 25MG APEXBIO TECHNOLOGIES
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Cayman Chemical ML-335, Purity: ≥98%, CAS: 825658-06-8, 5 mg
An activator of K2P2.1/TREK1 and K2P10.1/TREK2 (EC50s = 14.3 and 5.2 µM, respectively, in Xenopus oocytes)
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC β Amyloid (1-42) (scrambled) TFA | 99.8% | 4514.04 (free base) | 5 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
β Amyloid (1-42) (scrambled) TFA serves as a negative control for β-Amyloid (1-42) human TFA (HY-P1363).
- Targets Amyloid-ß.
- Involved in Neuronal Signaling pathway.
- Appears as a white to off-white solid.
- Purity by HPLC is 99.8%.
- Molecular weight is 4514.04 (free base).
- Sequence shortening: AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA.
- Powder can be stored at -80°C for 2 years or -20°C for 1 year.
- When in solvent, store at -80°C for 6 months or -20°C for 1 month.
- In vitro solubility in DMSO is 25 mg/mL (ultrasonic needed).
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
AdipoGen Hexadecylpyrene-1-sulfonamide
Chemical. CAS 351002-71-6. Formula C32H43NO2S. MW 505.8. Synthetic. Fluorescent probe. Spectral properties lambdaex=350nm lambdaem=400nm in MeOH. May be used in the analysis of drug delivery devices for lipophilic pyrenyl compounds.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Demecarium Bromide | 56-94-0 | 95.0% | 25 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Demecarium Bromide is described as a potent cholinesterase inhibitor, with an apparent affinity (Kiapp) of 0.15 μM. It is also used as a glaucoma agent.
- Potent cholinesterase inhibitor
- Apparent affinity (Kiapp) of 0.15 μM
- Used as a glaucoma agent
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
AdipoGen TOFA (5 mg)
TOFA (5 mg), Adipogen Life Sciences. Chemical. CAS: 54857-86-2. Formula: C19H32O4. MW: 324.5. . Fatty acid synthase (FASN) inhibitor. Cell-permeable, potent, reversible and competitive inhibitor of acetyl-CoA carboxylase (ACC) consequently bocking the synthesis of malonyl-CoA. Useful agent for immunometabolism research. Anticancer agent. Induces apoptosis in a variety of tumor cell lines. Relatively non-cytotoxic to various cancer cell lines. TOFA-induced reduction in malonyl-CoA is reported to off-set the effect of C75 on food intake in fasted mice and on apoptosis in tumor cells. Hypolipidemic agent. Stimulates citrate accumulation in the cell, which leads to a suppression of glycolysis by citrate-induced inhibition of phosphofructokinase.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Cayman Chemical GKT136901, Purity: ≥95%, CAS: 955272-06-7, 50 mg
A dual inhibitor of NOX1 and NOX4 (Kis = 160 and 165 nM, respectively); selective for NOX1 and NOX4 over NOX2 and xanthine oxidase (Kis = 1,530 and >30,000 nM, respectively), as well as a panel of 18 enzymes and ion channels at 10 µM; scavenges peroxynitrite radicals, as well as prevents the nitration and dimer formation of α-synuclein, in cell-free assays at 0.1, 1, and 10 µM; prevents peroxynitrite-induced cell death of differentiated LUHMES cells at 10 µM
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Cayman Chemical para-fluoro 4-Anilinopiperidine (hydrochloride), Purity: ≥98%, CAS: 1193389-70-6, 5 mg
An analytical reference standard that is structurally similar to known opioids; intended for research and forensic applications
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Medchemexpress LLC Peanut Oil | 8002-03-7 | 50 ML
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Peanut Oil can be used as a pharmaceutical excipient.
- Improves stability of pharmaceutical preparations
- Improves solubility of pharmaceutical preparations
- Improves processability of pharmaceutical preparations
- Affects absorption, distribution, metabolism, and elimination (ADME) processes of co-administered drugs
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More